DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb6

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001365764.1 Gene:Dnajb6 / 23950 MGIID:1344381 Length:372 Species:Mus musculus


Alignment Length:246 Identity:71/246 - (28%)
Similarity:100/246 - (40%) Gaps:107/246 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            ||::|||:.:|:|:::||||||.|||:||||||...|    |||.:::||||||||.||.:||:.
Mouse     4 YYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKY 68

  Fly    68 GEAAIKKGGADSG-----------DFRNPMDFFEKFF---------------------------- 93
            |:..:..||...|           .||||.|.|.:||                            
Mouse    69 GKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGN 133

  Fly    94 ---GAG-----------------------------------------FGGSGGGRRRE------- 107
               |||                                         |||||.|..:.       
Mouse   134 RSRGAGSFFSTFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKI 198

  Fly   108 RRGKDVV-------HQMSVQLEELYNGATRKLQL----QKNVICDKCEGRG 147
            ..||.:.       .|..|::||  :|..:.|.:    .:|.:.::|:.||
Mouse   199 VNGKKITTKRIVENGQERVEVEE--DGQLKSLTINGVADENALAEECQRRG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 71/246 (29%)
DnaJ 7..65 CDD:278647 36/61 (59%)
DnaJ_C 112..336 CDD:199909 10/47 (21%)
DnaJ_zf 140..206 CDD:199908 3/8 (38%)
Dnajb6NP_001365764.1 Interaction with HSP70. /evidence=ECO:0000250 1..147 53/142 (37%)
DnaJ 2..>138 CDD:223560 50/133 (38%)
Interaction with KRT18. /evidence=ECO:0000250 120..235 17/116 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.