DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajc11

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_766292.2 Gene:Dnajc11 / 230935 MGIID:2443386 Length:559 Species:Mus musculus


Alignment Length:203 Identity:53/203 - (26%)
Similarity:79/203 - (38%) Gaps:68/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN-----PNEGEK-FKAISQAYEVLSDADKRQVYD 65
            ||.:|.|:..|:.:|||.|||:|.:.|||||:     .::.|: |..:.||||||||...|.:||
Mouse    15 YYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYD 79

  Fly    66 ---------EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERR------------ 109
                     ||.|...:|        |.|.:..|:|       ....|.||.|            
Mouse    80 IYGKRGLEMEGWEVVERK--------RTPAEIREEF-------ERLQREREERRLQQRTNPKGTI 129

  Fly   110 -----GKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCE-------------------GRGGKK 150
                 ..|:..:...:.|::......::::.|..|....|                   |.||  
Mouse   130 SVGVDATDLFDRYDEEYEDVSGSGFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGG-- 192

  Fly   151 GSIEKCLQ 158
            ||:...|:
Mouse   193 GSVNFALR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 53/203 (26%)
DnaJ 7..65 CDD:278647 28/63 (44%)
DnaJ_C 112..336 CDD:199909 11/66 (17%)
DnaJ_zf 140..206 CDD:199908 7/38 (18%)
Dnajc11NP_766292.2 DnaJ 14..79 CDD:278647 28/63 (44%)
Selenoprotein_S 372..>447 CDD:284376
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.