DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJC8

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_055095.2 Gene:DNAJC8 / 22826 HGNCID:15470 Length:253 Species:Homo sapiens


Alignment Length:192 Identity:45/192 - (23%)
Similarity:82/192 - (42%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEK----FKAISQAYEVLSDAD--------- 59
            :::|.:.|..|.:|:||.:|:|::..|||||.::.::    |:|:.:||::|.|.:         
Human    59 FEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVI 123

  Fly    60 --------------KRQVYDEGGEAAIKKGGAD---SGDFRNPMDFFEKFFGAGFGGSGGGRRRE 107
                          |:|:..||....:::...:   ...::..|..|.:.         ..:|:|
Human   124 QAGKEYVEHTVKERKKQLKKEGKPTIVEEDDPELFKQAVYKQTMKLFAEL---------EIKRKE 179

  Fly   108 RRGKDVVHQMSVQLE---ELYNGATRKLQLQKNVICDKCEGRGGK-----------KGSIEK 155
            |..|: :|:...|.|   |....|.|:.:.|||..    |.|.|:           ||..||
Human   180 REAKE-MHERKRQREEEIEAQEKAKREREWQKNFE----ESRDGRVDSWRNFQANTKGKKEK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 45/192 (23%)
DnaJ 7..65 CDD:278647 21/83 (25%)
DnaJ_C 112..336 CDD:199909 16/58 (28%)
DnaJ_zf 140..206 CDD:199908 7/27 (26%)
DNAJC8NP_055095.2 CbpA 51..>238 CDD:225124 45/192 (23%)
DnaJ 57..112 CDD:99751 18/52 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..253 17/61 (28%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 189..192 0/2 (0%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 203..206 1/2 (50%)
Essential for polyglutamine aggregation suppression. /evidence=ECO:0000269|PubMed:27133716 232..253 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.