powered by:
Protein Alignment Droj2 and dnj-14
DIOPT Version :9
Sequence 1: | NP_650283.1 |
Gene: | Droj2 / 41646 |
FlyBaseID: | FBgn0038145 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257015.1 |
Gene: | dnj-14 / 180746 |
WormBaseID: | WBGene00001032 |
Length: | 217 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 41/70 - (58%) |
Similarity: | 53/70 - (75%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 YDILGVKPNATPDELKKAYRKLALKYHPDKN----PNEGEKFKAISQAYEVLSDADKRQVYDEGG 68
|::||::.|||.||:|||||||||:|||||| |.:.|.||.|:.|..|||:.:||:||||.|
Worm 40 YNVLGIQKNATDDEIKKAYRKLALRYHPDKNLDGDPEKTEMFKEINYANAVLSNPNKRRVYDEMG 104
Fly 69 EAAIK 73
|..:|
Worm 105 ETGLK 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.