DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnj-8

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001040753.1 Gene:dnj-8 / 174093 WormBaseID:WBGene00001026 Length:813 Species:Caenorhabditis elegans


Alignment Length:246 Identity:61/246 - (24%)
Similarity:98/246 - (39%) Gaps:67/246 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE--KFKAISQAYEVLSDADKRQVYDEGGEA 70
            |.:||:...|:..|:|.||:.||.::||||..:|..  :|..|::|||||||..:::.||..|..
 Worm    24 YKVLGISRRASAKEIKSAYKSLAREWHPDKRKDEAASGRFMEIAEAYEVLSDPLRKERYDRFGTF 88

  Fly    71 AIKKGGADSGDFRNPMDFFEKFFG-AGFGGSGGGRRRERRGKDVVHQMSVQ------LEE----- 123
                  .|...|.:..:....|:| .||||.|    .:....:..::||.|      |||     
 Worm    89 ------DDVKQFEDNAERARSFYGFGGFGGFG----FDESVFEYKYRMSYQQYQFKILEESNTKP 143

  Fly   124 ----LYNGATR---KLQLQ-KNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIE 180
                :|:...:   :...| |.||.|               |:..|.|:.|              
 Worm   144 YIVYIYSNYCQMCYRFHPQWKRVIAD---------------LEPLGYGIAT-------------- 179

  Fly   181 QVCRKCSGTGE-TIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVF 230
                 .:|..| .:.||.|..:......:.|.:::.:.|:....|...:.|
 Worm   180 -----VNGNREQNLMEKMRISHVPALVAIVEGRIIPMRIDSSFSDRSIVAF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 61/246 (25%)
DnaJ 7..65 CDD:278647 24/58 (41%)
DnaJ_C 112..336 CDD:199909 25/139 (18%)
DnaJ_zf 140..206 CDD:199908 10/66 (15%)
dnj-8NP_001040753.1 DnaJ_bact 22..>86 CDD:274090 26/61 (43%)
TRX_DnaJ 118..229 CDD:239261 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.