DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AgaP_AGAP000831

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_316797.3 Gene:AgaP_AGAP000831 / 1277341 VectorBaseID:AGAP000831 Length:341 Species:Anopheles gambiae


Alignment Length:212 Identity:56/212 - (26%)
Similarity:85/212 - (40%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPD--KNPNE----GEKFKAISQAYEVLSDADKRQVYDE 66
            |::|||...:|..|:.|:||:||.|||||  ..|.:    .|.||.|:.|||||.|.:.|..|:.
Mosquito    38 YELLGVSRESTKQEIAKSYRQLARKYHPDLHHGPEQKQAAEESFKRIATAYEVLKDEESRNDYNY 102

  Fly    67 GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGK-DV--VHQMSVQLEELYNGA 128
                          ...||..::..|:          |...|:.| ||  |..:::.:.......
Mosquito   103 --------------LLDNPQAYYAHFY----------RYYRRKAKIDVRLVIVVTISIISCIQYV 143

  Fly   129 TR---------------KLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQ-QIAPGIMQ 177
            ||               |.:.:...:.::..|.||..|         |:|.:.|:: ..|....:
Mosquito   144 TRWQRYDTAIKYFMSLPKYRNKAMEMINQSNGGGGGGG---------GSGKQGRIKLSKAEQRKE 199

  Fly   178 HIEQVCRKCSGTGETIQ 194
            |.||: ||.......||
Mosquito   200 HDEQI-RKVIENNMDIQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 56/212 (26%)
DnaJ 7..65 CDD:278647 28/62 (45%)
DnaJ_C 112..336 CDD:199909 21/101 (21%)
DnaJ_zf 140..206 CDD:199908 15/56 (27%)
AgaP_AGAP000831XP_316797.3 DnaJ 36..101 CDD:278647 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.