powered by:
Protein Alignment Droj2 and AgaP_AGAP010609
DIOPT Version :9
Sequence 1: | NP_650283.1 |
Gene: | Droj2 / 41646 |
FlyBaseID: | FBgn0038145 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_314571.3 |
Gene: | AgaP_AGAP010609 / 1275333 |
VectorBaseID: | AGAP010609 |
Length: | 153 |
Species: | Anopheles gambiae |
Alignment Length: | 68 |
Identity: | 24/68 - (35%) |
Similarity: | 40/68 - (58%) |
Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YYDILGVKPNATPDELKKAYRKLALKYHPDK---------NPNEGEKFKAISQAYEVLSDADKRQ 62
:||:|.|...||.:|::::|:.|||:||||| .....::|..|.:|::.|.|...|:
Mosquito 14 FYDVLEVSRTATLEEIRRSYQTLALRYHPDKRKASEREASGDERADQFIRIDEAWKTLRDERLRR 78
Fly 63 VYD 65
:||
Mosquito 79 IYD 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.