DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AgaP_AGAP010609

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_314571.3 Gene:AgaP_AGAP010609 / 1275333 VectorBaseID:AGAP010609 Length:153 Species:Anopheles gambiae


Alignment Length:68 Identity:24/68 - (35%)
Similarity:40/68 - (58%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDK---------NPNEGEKFKAISQAYEVLSDADKRQ 62
            :||:|.|...||.:|::::|:.|||:|||||         .....::|..|.:|::.|.|...|:
Mosquito    14 FYDVLEVSRTATLEEIRRSYQTLALRYHPDKRKASEREASGDERADQFIRIDEAWKTLRDERLRR 78

  Fly    63 VYD 65
            :||
Mosquito    79 IYD 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 24/68 (35%)
DnaJ 7..65 CDD:278647 22/66 (33%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
AgaP_AGAP010609XP_314571.3 DnaJ 13..81 CDD:278647 22/66 (33%)
zf-CSL 95..148 CDD:304506
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.