DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Droj2 and AgaP_AGAP002752

DIOPT Version :9

Sequence 1:	NP_650283.1	Gene:	Droj2 / 41646	FlyBaseID:	FBgn0038145	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	XP_312173.2	Gene:	AgaP_AGAP002752 / 1273218	VectorBaseID:	AGAP002752	Length:	495	Species:	Anopheles gambiae

Alignment Length:	102	Identity:	39/102 - (38%)
Similarity:	52/102 - (50%)	Gaps:	25/102 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE-----GEKFKAISQAYEVLSDADKRQVYDE 66
            ||.|||||..||..|:.|||||.|.|:|||....:     .:||..::.|.|||:|.:||:.:|.
Mosquito   395 YYKILGVKRTATKQEIVKAYRKAAQKWHPDNYQGDQKKMAEKKFIDVAAAKEVLTDPEKRRQFDA 459

  Fly    67 GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGG 103
            |               ::|:|     ..||..|.|||
Mosquito   460 G---------------QDPLD-----PEAGRNGFGGG 476

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Droj2	NP_650283.1	PTZ00037	2..398	CDD:240236	39/102 (38%)
		DnaJ	7..65	CDD:278647	29/62 (47%)
		DnaJ_C	112..336	CDD:199909
		DnaJ_zf	140..206	CDD:199908
AgaP_AGAP002752	XP_312173.2	TPR_11	40..106	CDD:290150
		TPR repeat	44..69	CDD:276809
		TPR repeat	74..104	CDD:276809
		TPR_11	76..140	CDD:290150
		TPR_1	77..108	CDD:278916
		TPR repeat	109..137	CDD:276809
		TPR repeat	143..183	CDD:276809
		TPR repeat	188..218	CDD:276809
		TPR repeat	223..251	CDD:276809
		TPR repeat	302..336	CDD:276809
		TPR_11	316..370	CDD:290150
		TPR repeat	340..368	CDD:276809
		TPR repeat	374..397	CDD:276809	1/1 (100%)
		DnaJ	393..>479	CDD:223560	39/102 (38%)
		DnaJ	394..458	CDD:278647	29/62 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910