DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Droj2 and AgaP_AGAP010432

DIOPT Version :9

Sequence 1:	NP_650283.1	Gene:	Droj2 / 41646	FlyBaseID:	FBgn0038145	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	XP_311513.4	Gene:	AgaP_AGAP010432 / 1272561	VectorBaseID:	AGAP010432	Length:	574	Species:	Anopheles gambiae

Alignment Length:	147	Identity:	42/147 - (28%)
Similarity:	60/147 - (40%)	Gaps:	47/147 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKA------ISQAYEVLSDADKRQ 62
            |..||..|.:..:||.:|:.||||.|:..:||||:.|...|.||      ..:|||||||..:|.
Mosquito    11 EQDYYATLNLPRSATQEEISKAYRNLSKIFHPDKHGNGENKQKAELMFNRTKKAYEVLSDPHQRA 75

  Fly    63 VYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSV--QLEELY 125
            :||                                  |.|.:..|..|.::||:...  ::.|.|
Mosquito    76 IYD----------------------------------SLGVKGLETEGWEIVHRTKTPNEIREEY 106

  Fly   126 NGAT-----RKLQLQKN 137
            ....     |:||.:.|
Mosquito   107 ERLAQEREERRLQQKTN 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Droj2	NP_650283.1	PTZ00037	2..398	CDD:240236	42/147 (29%)
		DnaJ	7..65	CDD:278647	27/63 (43%)
		DnaJ_C	112..336	CDD:199909	8/33 (24%)
		DnaJ_zf	140..206	CDD:199908
AgaP_AGAP010432	XP_311513.4	DnaJ	11..>89	CDD:223560	33/111 (30%)
		DnaJ	13..78	CDD:278647	27/64 (42%)
		DUF3395	410..548	CDD:288708
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910