DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Droj2 and AgaP_AGAP003729

DIOPT Version :9

Sequence 1:	NP_650283.1	Gene:	Droj2 / 41646	FlyBaseID:	FBgn0038145	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	XP_310260.5	Gene:	AgaP_AGAP003729 / 1271462	VectorBaseID:	AGAP003729	Length:	225	Species:	Anopheles gambiae

Alignment Length:	64	Identity:	32/64 - (50%)
Similarity:	45/64 - (70%)	Gaps:	3/64 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYDEG 67
            :||.|||.|:||.:::|:||.||:..||||||...   .|||:.|:.|||||.:...|::||:|
Mosquito    38 HYDSLGVTPSATQNDIKQAYYKLSKLYHPDKNKGSEVAAEKFRDITAAYEVLGNYRLRKLYDKG 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Droj2	NP_650283.1	PTZ00037	2..398	CDD:240236	32/64 (50%)
		DnaJ	7..65	CDD:278647	29/60 (48%)
		DnaJ_C	112..336	CDD:199909
		DnaJ_zf	140..206	CDD:199908
AgaP_AGAP003729	XP_310260.5	DnaJ	36..>99	CDD:223560	29/60 (48%)
AgaP_AGAP003729	XP_310260.5	DnaJ	37..99	CDD:278647	29/60 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910