DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AgaP_AGAP007620

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_308251.4 Gene:AgaP_AGAP007620 / 1269608 VectorBaseID:AGAP007620 Length:217 Species:Anopheles gambiae


Alignment Length:68 Identity:36/68 - (52%)
Similarity:47/68 - (69%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYDEGGE 69
            |..||::..||.||:||.|||||||||||||||.   .:|||.:::|:.:|||..||.:||..|.
Mosquito    14 YQTLGLQKTATADEIKKTYRKLALKYHPDKNPNNPDAADKFKEVNRAHSILSDLTKRNIYDNYGS 78

  Fly    70 AAI 72
            ..:
Mosquito    79 LGL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 36/68 (53%)
DnaJ 7..65 CDD:278647 33/59 (56%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
AgaP_AGAP007620XP_308251.4 DnaJ 12..74 CDD:278647 33/59 (56%)
DnaJ 14..>81 CDD:223560 36/66 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.