powered by:
Protein Alignment Droj2 and AgaP_AGAP007620
DIOPT Version :9
Sequence 1: | NP_650283.1 |
Gene: | Droj2 / 41646 |
FlyBaseID: | FBgn0038145 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_308251.4 |
Gene: | AgaP_AGAP007620 / 1269608 |
VectorBaseID: | AGAP007620 |
Length: | 217 |
Species: | Anopheles gambiae |
Alignment Length: | 68 |
Identity: | 36/68 - (52%) |
Similarity: | 47/68 - (69%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYDEGGE 69
|..||::..||.||:||.|||||||||||||||. .:|||.:::|:.:|||..||.:||..|.
Mosquito 14 YQTLGLQKTATADEIKKTYRKLALKYHPDKNPNNPDAADKFKEVNRAHSILSDLTKRNIYDNYGS 78
Fly 70 AAI 72
..:
Mosquito 79 LGL 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.