DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and zgc:152986

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001275586.1 Gene:zgc:152986 / 101884054 ZFINID:ZDB-GENE-061013-762 Length:177 Species:Danio rerio


Alignment Length:99 Identity:44/99 - (44%)
Similarity:57/99 - (57%) Gaps:14/99 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVY----- 64
            ||.:|||....:..::|||:.|||||:|||||  ||..:.|..|:||||||||.:||:||     
Zfish    23 YYSVLGVSRFVSSRDIKKAFHKLALKHHPDKNQTPNAQQTFTHIAQAYEVLSDREKRRVYDQMDH 87

  Fly    65 ----DEGGEAAIKKGGAD---SGDFRNPMDFFEK 91
                |:|.|..:||...:   |..|.|...|..|
Zfish    88 LSNPDQGSERMVKKDQTEDMGSNLFSNKGSFQSK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 44/99 (44%)
DnaJ 7..65 CDD:278647 34/68 (50%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
zgc:152986NP_001275586.1 DnaJ 22..83 CDD:278647 33/59 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.