DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJB6

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_005249572.1 Gene:DNAJB6 / 10049 HGNCID:14888 Length:334 Species:Homo sapiens


Alignment Length:348 Identity:92/348 - (26%)
Similarity:131/348 - (37%) Gaps:114/348 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            ||::|||:.:|:|:::||||||||||:||||||...|    |||.:::||||||||.||.:||:.
Human     4 YYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKY 68

  Fly    68 GEAAIKKGGADSG----------DFRNPMDFFEKFFGAG---------------FGGSGGGRRRE 107
            |:..:..||....          .||||.|.|.:|||..               ||...|.|...
Human    69 GKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSR 133

  Fly   108 RRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVE------T 166
            .||.                                    |...|........|:|..      |
Human   134 SRGT------------------------------------GSFFSAFSGFPSFGSGFSSFDTGFT 162

  Fly   167 RVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLE-----VHIEKGMRDGQ 226
            ....:..|.:..........||.|.........|..:||| :..::::|     |.:|:   |||
Human   163 SFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRK-ITTKRIVENGQERVEVEE---DGQ 223

  Fly   227 --KIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDR 289
              .:...|..|.:         .|.:|:     ...||:.:...|..|        |..|     
Human   224 LKSLTINGVADDD---------ALAEER-----MRRGQNALPAQPAGL--------RPPK----- 261

  Fly   290 DLIVSTQPGEVIRHEMTKCIAEE 312
                ..:|..::|| ...|::||
Human   262 ----PPRPASLLRH-APHCLSEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 92/348 (26%)
DnaJ 7..65 CDD:278647 37/61 (61%)
DnaJ_C 112..336 CDD:199909 35/214 (16%)
DnaJ_zf 140..206 CDD:199908 11/71 (15%)
DNAJB6XP_005249572.1 DnaJ 2..>106 CDD:223560 50/101 (50%)
DnaJ 3..66 CDD:278647 37/61 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.