DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnaja3

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001120377.1 Gene:dnaja3 / 100145451 XenbaseID:XB-GENE-5718163 Length:457 Species:Xenopus tropicalis


Alignment Length:398 Identity:111/398 - (27%)
Similarity:177/398 - (44%) Gaps:44/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKN---PNEGEKFKAISQAYEVLSDADKRQVYD 65
            :|.:|.:|||..||:..|:||||.:||.|||||.|   |...|||..:::|||||||..||:.||
 Frog    65 KTDFYQVLGVPRNASQKEIKKAYYQLAKKYHPDTNKEDPQAKEKFSQLAEAYEVLSDEVKRKQYD 129

  Fly    66 EGGEAAIKKGGADSGDFR--------NPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLE 122
            ..|.|....|.|..|..:        :|.:.|.|.||. |.||..|.......:...:.|.:...
 Frog   130 TYGTADFAAGAAGGGGQQYWRGGPTVDPEELFRKIFGE-FSGSPFGDLGSMFEQPQEYIMDLTFI 193

  Fly   123 ELYNGATRKLQLQKNVICDKCEGRGGKKGS-IEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKC 186
            :...|..:::.:.....|.:|:|:|.:.|: ::.|..|.|.|:||  ....|.:|:   ..||:|
 Frog   194 QAAKGVNKQISVNITDTCQRCDGKGNEPGTKLQHCHYCNGTGMET--INTGPFVMR---STCRRC 253

  Fly   187 SGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDE 251
            .|.|.|:  .:.|.:|.|....:::|.:.|.:..|:.|||.:       ..|..:. :|.|....
 Frog   254 GGKGATM--TNPCLSCRGSGQTKQKKTVTVPVPAGVEDGQTV-------RMPVGKK-EIFITFRV 308

  Fly   252 KEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDR---DLIVSTQPGEVIRHEMTKCIAEEG 313
            ::...|...|.|:...:.:.:.:|:.|.....:.|.|.   .:...||..:.||      |:.:|
 Frog   309 QKSPIFRRDGADIHSDLYISIAQAVLGGSARAQGLYDPINVPVPAGTQADQRIR------ISGKG 367

  Fly   314 MPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQ 378
            :|.. |....|...|..:|..|..:      |.:|.:......:...|.|.||....:....|.|
 Frog   368 IPRM-NSYGFGDHYIHIKVRVPRHL------TDRQRMLMLSFAEDETDVEGTVNGITNTTTGRNQ 425

  Fly   379 HQRMAYDE 386
            |:....:|
 Frog   426 HRSATGEE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 111/398 (28%)
DnaJ 7..65 CDD:278647 32/60 (53%)
DnaJ_C 112..336 CDD:199909 51/227 (22%)
DnaJ_zf 140..206 CDD:199908 22/66 (33%)
dnaja3NP_001120377.1 DnaJ 65..457 CDD:223560 111/398 (28%)
DnaJ 67..129 CDD:278647 32/61 (52%)
DnaJ_C 182..391 CDD:199909 52/230 (23%)
DnaJ_zf 211..271 CDD:199908 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.