DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnajc18

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001096348.1 Gene:dnajc18 / 100124938 XenbaseID:XB-GENE-5795683 Length:483 Species:Xenopus tropicalis


Alignment Length:140 Identity:48/140 - (34%)
Similarity:66/140 - (47%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEG--EKFKAISQAYEVLSDADKRQVYD 65
            :|..||.:|||..:|..:.::|||.||||:||||||.:.|  |.||||.:|:.||||..:|:.||
 Frog   108 EEDDYYSLLGVSKDANEETVRKAYLKLALRYHPDKNSSPGATETFKAIGKAFSVLSDPAQRKSYD 172

  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGG----------------------------SGG 102
               :|..|.......|.... |.|:.||...|.|                            ...
 Frog   173 ---DAQAKARVVSQPDLTTE-DLFDLFFKGHFPGYAFSQQYQQPRSTNRRQGDRGQRWEEEEEED 233

  Fly   103 GRRRERRGKD 112
            ||::.|:|:|
 Frog   234 GRQQWRQGED 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 48/140 (34%)
DnaJ 7..65 CDD:278647 31/59 (53%)
DnaJ_C 112..336 CDD:199909 1/1 (100%)
DnaJ_zf 140..206 CDD:199908
dnajc18NP_001096348.1 DnaJ 111..172 CDD:306689 31/60 (52%)
Rho <213..>346 CDD:333130 5/31 (16%)
DUF1977 375..473 CDD:312722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.