DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG34171

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:274 Identity:54/274 - (19%)
Similarity:101/274 - (36%) Gaps:104/274 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLY------- 174
            |.|.::.|.:|||:|||:               ..::....:|.|.:|   ...|.|:       
  Fly    57 CTGVILTNRHVLTSAHCI---------------TDKNGVMMSPKRIVV---ALCASLFKTPESEE 103

  Fly   175 MEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRA----IQPICLPRAQK------------ 223
            ..:::..:|.|..::|.:.  ||||:::||   ||.:.    :.|:.|..:..            
  Fly   104 FVVDIHNMIIHPYYHRNQH--NDIAIIKLK---RYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGI 163

  Fly   224 LAAHKRKFQASGWPDMGQGIASEVLL---------------RSFIAERHPD----VCKSNYDFNL 269
            ....:::|          |....:||               :|.:|.| |:    :|..:.:   
  Fly   164 FGVRRQRF----------GSFHSMLLVNVELRPFDECLKVKKSLMAAR-PENEDLICVKSTE--- 214

  Fly   270 GSQICAGGLDGNDTSPGDSGGPLM-ETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYF 333
             .|:|.          .|.||||. :..:.|          |:.|...|  .:..|.|::..|::
  Fly   215 -KQMCT----------TDFGGPLFCDGQLYG----------IALGSINC--SSPDPVFFSDVSFY 256

  Fly   334 FEWIKSKLQSPFID 347
            ..|: :|:.|..:|
  Fly   257 NSWV-TKIISEAVD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 51/265 (19%)
Tryp_SPc 93..337 CDD:214473 50/262 (19%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 50/262 (19%)
Tryp_SPc 38..263 CDD:304450 51/266 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.