DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:273 Identity:66/273 - (24%)
Similarity:115/273 - (42%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR 149
            |.|.:.:..:.|::..:...:..|...     ||||:|.:.:|||||||                
  Fly    42 TNGNLASEGQVPYIVGVSLNSNGNWWW-----CGGSIIGHTWVLTAAHC---------------- 85

  Fly   150 LGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLI---NDIALVRLKFP-VRYT 210
                 |:...:.::..|    |..|.|......::.|.|.|....:   :|:||:  |.| |.:.
  Fly    86 -----TAGADEASLYYG----AVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALI--KTPHVDFY 139

  Fly   211 RAIQPICLPRA-QKLAAHKRKF-QASGWPDM--GQGIASEVLLRSF----IAERHPDVCKSNYDF 267
            ..:..|.||.. .:..:::..: ||:||..:  |..:..::.:...    :||     |::.|..
  Fly   140 SLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAE-----CQAYYGT 199

  Fly   268 NLGSQ--ICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCK---PAFY 327
            :..|:  ||....||..|..|||||||:..  .|...:...:.:.:||        |:   ||.:
  Fly   200 DTASENTICVETPDGKATCQGDSGGPLVTK--EGDKLIGITSFVSAYG--------CQVGGPAGF 254

  Fly   328 TKTSYFFEWIKSK 340
            |:.:.:.||||.:
  Fly   255 TRVTKYLEWIKEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 64/263 (24%)
Tryp_SPc 93..337 CDD:214473 61/260 (23%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 63/268 (24%)
Tryp_SPc 41..266 CDD:238113 65/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.