DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG11842

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:277 Identity:78/277 - (28%)
Similarity:120/277 - (43%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PAL-NEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEH 153
            ||: .|||..|.|.:.::|...:..   |||:||::.:|||||||...|    ..::...|||:.
  Fly    78 PAVPKEFPHAARLGHKDENGEVEWF---CGGTLISDRHVLTAAHCHYSP----QGSVNIARLGDL 135

  Fly   154 NTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICL 218
            ...||.|.|...          :.:|.....|.:|:. ..:.|||::|||..||.:.....|.||
  Fly   136 EFDTNNDDADPE----------DFDVKDFTAHPEFSY-PAIYNDISVVRLSRPVTFNDYKHPACL 189

  Fly   219 PRAQ-KLAAHKRKFQASGWPDMGQGIASEVLLRS------------------FIAERHPDVCKSN 264
            |... :|..   .|.|.||..:      |::.|:                  ..|:|:.::.:. 
  Fly   190 PFDDGRLGT---SFIAIGWGQL------EIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEG- 244

  Fly   265 YDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTY-AAGIISYGQKPCVLKTCK----P 324
              :|..:|:|.|..:..||..||||||::  :........| ..||.|.|      ..|.    |
  Fly   245 --YNATTQLCIGSNEHKDTCNGDSGGPVL--IYHMDYPCMYHVMGITSIG------VACDTPDLP 299

  Fly   325 AFYTKTSYFFEWIKSKL 341
            |.||:..::.:|||.:|
  Fly   300 AMYTRVHFYLDWIKQQL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/270 (28%)
Tryp_SPc 93..337 CDD:214473 72/267 (27%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 77/274 (28%)
Tryp_SPc 73..312 CDD:214473 74/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.