DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG31219

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:355 Identity:143/355 - (40%)
Similarity:189/355 - (53%) Gaps:39/355 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLMLQIILVPYSNGAGCQFDTECVNLDKCP------RTRAVMNSSRKN---IIGLRRCGTNKVC 64
            |.|::..|.:.:|..:.|....:.|.|.:||      |:|.:|.....:   :.|.|      :|
  Fly     8 FALVVVFIQLAHSTNSDCYPGEKYVYLYECPHVYTAGRSRTLMREYDMDAWLLFGQR------IC 66

  Fly    65 CPKWETYLPH-DTCGQ--SRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWY 126
            ||.....||. :.|||  |..:...|.....|.:||||||||.|...|  :::|.|.||||||.|
  Fly    67 CPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTL--EILPFCAGSLINNRY 129

  Fly   127 VLTAAHCVEYPFMDYPYALKTVRLGEH----NTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQ 187
            |||:||||.....|  .:||:||||||    :.:.|||  ..:...|.|...:||::::||.|..
  Fly   130 VLTSAHCVNGIPRD--LSLKSVRLGEHDITYDPAYNPD--CRDQDNQCALPNLEIKLEKIIVHGL 190

  Fly   188 FN--RGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLR 250
            |:  ..|.:..||||:|||.||||...|.|||:|:....|  |.|.:.:||....:|..|:||:.
  Fly   191 FSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFA--KSKLEIAGWGKTNEGQFSQVLMH 253

  Fly   251 SFIAERHPDVCKSNY---DFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISY 312
            .||.||...||...:   |.|...||||||.||.||..||||||||.|:....|   |.|||.:|
  Fly   254 GFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV---YLAGITTY 315

  Fly   313 GQKPCVLKTCKPAFYTKTSYFFEWIKSKLQ 342
            |.|.|. :...|..||:||.|..|||:.|:
  Fly   316 GSKNCG-QIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 118/255 (46%)
Tryp_SPc 93..337 CDD:214473 115/252 (46%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 116/262 (44%)
Tryp_SPc 90..342 CDD:238113 119/263 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.