DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG5255

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:101/241 - (41%) Gaps:46/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTS----TNPDRAIVNGRRQYAPLYMEI 177
            |||::|:..:::|||||..               |...|:    |.......||.:.|.|     
  Fly    57 CGGAIIDERWIITAAHCTR---------------GRQATAFRVLTGTQDLHQNGSKYYYP----- 101

  Fly   178 EVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQG 242
              |:|:.|..: ..|:..|||||:.|...:.:..|.||:.|.. :.|....| ...:||..:..|
  Fly   102 --DRIVEHSNY-APRKYRNDIALLHLNESIVFDNATQPVELDH-EALVPGSR-LLLTGWGTLSLG 161

  Fly   243 IASEVLLRSFIAERHP-DVCKSNYD----FNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVT 302
            ......|:|......| :.|::.:|    .::| .:|.....|.....|||||||   |..||: 
  Fly   162 GDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIG-HVCTFNDKGRGACHGDSGGPL---VHNGKL- 221

  Fly   303 LTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKLQSPFIDS 348
                ..::::| .||.  ...|..:...||:.::|::.|.....||
  Fly   222 ----VALVNWG-LPCA--KGYPDAHASISYYHDFIRTHLSLSKTDS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 60/231 (26%)
Tryp_SPc 93..337 CDD:214473 59/228 (26%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 59/228 (26%)
Tryp_SPc 30..252 CDD:238113 60/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.