DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG17475

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:236 Identity:64/236 - (27%)
Similarity:97/236 - (41%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPD-RAIVNGRRQYAPLYMEIEVD 180
            |||.:|:..:||||||||      |.|              ||. ..::.|..:|........|:
  Fly    76 CGGCIIDERHVLTAAHCV------YGY--------------NPTYLRVITGTVEYEKPDAVYFVE 120

  Fly   181 QIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQ---- 241
            :...|..:| .....|||||:||...:::....||..||.|.  .|:..:...:||   |.    
  Fly   121 EHWIHCNYN-SPDYHNDIALIRLNDTIKFNEYTQPAELPTAP--VANGTQLLLTGW---GSTELW 179

  Fly   242 GIASEVLLRSFIAERHPDVCK---SNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTL 303
            |...::|.::::.......|:   :|...|....||.....|.....|||||||....:      
  Fly   180 GDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGV------ 238

  Fly   304 TYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKLQSP 344
              ..|::::|. ||.|..  |..:....|:.|||:|.:..|
  Fly   239 --LYGLVNWGY-PCALGV--PDSHANVYYYLEWIRSMISGP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 62/230 (27%)
Tryp_SPc 93..337 CDD:214473 60/227 (26%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 60/227 (26%)
Tryp_SPc 50..269 CDD:238113 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.