DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG31265

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:122/275 - (44%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GQSRRKPTKGKIPALNEF-PWMAML--LYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFM 139
            |||.|  .||...|...| |:...|  :.|:.|         |||:::|..:::||.||||    
  Fly    32 GQSGR--IKGGEEAEIGFAPYQVSLQPIVGSHN---------CGGAILNENWIITAGHCVE---- 81

  Fly   140 DYPYALKTVRLGEHNTSTNPDRAIVNGRRQYA---PLYMEIEVDQIITHEQFNRGRRLINDIALV 201
            ::..||..|               :.|..::|   .:|...|:.:...::|    ..:.||||||
  Fly    82 NFIPALVNV---------------ITGTNKWAEPGAIYYTAEIHKHCMYDQ----PYMHNDIALV 127

  Fly   202 RLKFPVRYTRAIQPICLP-RAQKLAAHKRKFQASGW-PDMGQGIASEVLLRSFIAERHPDVCKSN 264
            :|...:.:....|||.|| |..:|.   .:...:|| .|:..|.:.|.|.:..:.....|.|...
  Fly   128 KLTENITFNELTQPIALPTRPVQLG---EEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYET 189

  Fly   265 YD--FNLG-SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAF 326
            ::  .::| ..||....:|.....|||||||   |..|::     .|::::| :||.:..  |..
  Fly   190 FNRTSSMGVGHICTFSREGEGACHGDSGGPL---VSNGQL-----VGVVNWG-RPCGVGL--PDV 243

  Fly   327 YTKTSYFFEWIKSKL 341
            .....|:.:||:|||
  Fly   244 QANVYYYLDWIRSKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 66/257 (26%)
Tryp_SPc 93..337 CDD:214473 64/254 (25%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 68/265 (26%)
Tryp_SPc 39..257 CDD:238113 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.