DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG31326

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:344 Identity:95/344 - (27%)
Similarity:133/344 - (38%) Gaps:98/344 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RAVMNSSRKNIIGLRRCGTNKVCCPKWETYLPHD------------TCGQSRRKPT----KGKIP 90
            |...|.||.|             .|:.....|.|            .||:.|...|    :||..
  Fly   229 RPTPNPSRSN-------------APQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSL 280

  Fly    91 ALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNT 155
            ...:.||:..:....::|....:   |||:||:...||:||||...|..|.|.:...|.||.:..
  Fly   281 QRGQLPWLVAIFERRESNGPAFI---CGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTL 342

  Fly   156 STNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPR 220
            :.:.|.....             |.|:|.||.|...:....|:|||||..|||||..|.||||  
  Fly   343 AIHSDGEFRG-------------VSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICL-- 392

  Fly   221 AQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPD--------VCKSNYDFNLGSQI-CA- 275
                      :..|...|:.||      |:|::|...||        |.|.. |.|:.|:. || 
  Fly   393 ----------WSTSNRMDLPQG------LKSYVAGWGPDETGTGNTEVSKVT-DLNIVSEANCAL 440

  Fly   276 ---------GGLDGNDTSPG----DSGGPLM-----ETVIRGKVTLTYAAGIISYGQKPCVLKTC 322
                     ..|....|..|    |.|||||     ..|:||.:    :.|:|:..:..|.|.  
  Fly   441 ELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVI----SGGVINEKENTCELS-- 499

  Fly   323 KPAFYTKTSYFFEWIKSKL 341
            ||:.:|..:...||::.|:
  Fly   500 KPSVFTDVAKHIEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 80/274 (29%)
Tryp_SPc 93..337 CDD:214473 79/271 (29%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 82/280 (29%)
Tryp_SPc 277..514 CDD:214473 81/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.