DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and snk

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:327 Identity:87/327 - (26%)
Similarity:139/327 - (42%) Gaps:69/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VNLDKCPRTRAVMNSSRKNIIGLRRCGTNKVCCPKWETYLPHDTCGQSRRKPTKGKIPALNEFPW 97
            ::..||....|.  :.|.::....|..:.|.|.|.    :|....|    .||:..:     ||.
  Fly   150 ISATKCQEYNAA--ARRLHLTDTGRTFSGKQCVPS----VPLIVGG----TPTRHGL-----FPH 199

  Fly    98 MAMLLY----GNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTN 158
            ||.|.:    |:|:   |.:...|||:|::..||||||||..                  :.|..
  Fly   200 MAALGWTQGSGSKD---QDIKWGCGGALVSELYVLTAAHCAT------------------SGSKP 243

  Fly   159 PDRAIVNGRR--QYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRA 221
            ||...:..|:  :.:....:|::..|:.|.:: |.....:||||::|...|:::..::|.||.:.
  Fly   244 PDMVRLGARQLNETSATQQDIKILIIVLHPKY-RSSAYYHDIALLKLTRRVKFSEQVRPACLWQL 307

  Fly   222 QKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDV-------CKSNYDFN-------LGSQ 272
            .:|..  ....|:||   |:   :|.|.....|.|..|:       ||..|...       :..|
  Fly   308 PELQI--PTVVAAGW---GR---TEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQ 364

  Fly   273 ICAGGL-DGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEW 336
            .|||.| .|.||..||||||: ..::.....:.:..||.|:| |.|..... |..||:...:.:|
  Fly   365 FCAGYLPGGRDTCQGDSGGPI-HALLPEYNCVAFVVGITSFG-KFCAAPNA-PGVYTRLYSYLDW 426

  Fly   337 IK 338
            |:
  Fly   427 IE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/267 (28%)
Tryp_SPc 93..337 CDD:214473 73/264 (28%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 78/285 (27%)
Tryp_SPc 186..427 CDD:214473 76/282 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.