DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG14088

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:275 Identity:65/275 - (23%)
Similarity:101/275 - (36%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDY 141
            ||:.|    .|..|.: ..||.|:|.:..      ::|..  |:||:..::||..||.:      
  Fly    31 CGERR----DGLSPDI-VGPWTAILHHFG------RIVGV--GTLIHERFILTDVHCGD------ 76

  Fly   142 PYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQII----THEQFNRGRRLINDIALVR 202
            ...:...||||                 |..:..|:..|.|:    ::..||...: .|::.|::
  Fly    77 SIGVIRARLGE-----------------YGRIGSELAEDHIVAAFFSNANFNPETQ-ANNMGLMK 123

  Fly   203 LKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVC-KS 263
            |...|.|...|.|:|:   .|.|..|.....|..:.|.:..:    ..:|||....|.|..| |.
  Fly   124 LLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSDK----SPMLRSKTVIRMPQACGKL 184

  Fly   264 NYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYT 328
            ::     .|.|||..| .|:....||..|...:.......|...||.:..:..|    .....||
  Fly   185 DH-----GQFCAGHKD-LDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKC----SNSRTYT 239

  Fly   329 KTSYFFEWIKSKLQS 343
            ......:||...:.|
  Fly   240 DVVQLHQWISMVIYS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 59/254 (23%)
Tryp_SPc 93..337 CDD:214473 57/251 (23%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 59/255 (23%)
Tryp_SPc 42..248 CDD:214473 57/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.