DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG7542

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:267 Identity:74/267 - (27%)
Similarity:120/267 - (44%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TKGKIPALNEFPWMAML--LYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKT 147
            |.|:...:.:||:.|.|  .:||.:..       |||:||::::::|||||     ||...:: |
  Fly    28 TNGEPAEVGQFPYQAGLNVSFGNWSTW-------CGGTLISHYWIITAAHC-----MDGAESV-T 79

  Fly   148 VRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRA 212
            |.||..|.....:    .|:.:     :.:|...||.|..: ....::|||:|:||...|.:|..
  Fly    80 VYLGAINIGDESE----EGQER-----IMVEKSGIIVHSNY-MASTVVNDISLIRLPAFVGFTDR 134

  Fly   213 IQPICLPRAQKLAAHKRKFQ-----ASGW---PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNL 269
            |:...|||  :|......::     ||||   .|....: |.||....:......:|:..:...:
  Fly   135 IRAASLPR--RLNGQFPTYESIRAFASGWGRESDASDSV-SPVLRYVEMPIMPHSLCRMYWSGAV 196

  Fly   270 GSQ-ICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCK---PAFYTKT 330
            ..: ||.....|..|..|||||||    :..:...:|..|..|:|..    ..|:   ||.:|:.
  Fly   197 SEKMICMSTTSGKSTCHGDSGGPL----VYKQGNSSYLIGSTSFGTS----MGCQVGFPAVFTRI 253

  Fly   331 SYFFEWI 337
            |.:.:||
  Fly   254 SSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 72/259 (28%)
Tryp_SPc 93..337 CDD:214473 70/257 (27%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 74/267 (28%)
Tryp_SPc 27..260 CDD:214473 72/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.