DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG18179

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:227 Identity:57/227 - (25%)
Similarity:90/227 - (39%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQII 183
            |::|.:.::||||||:...:::..|.        .|...|      ...||      .:..|..|
  Fly    72 GTIIASDWILTAAHCLTTDYVEIHYG--------SNWGWN------GAFRQ------SVRRDNFI 116

  Fly   184 THEQF--NRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKF-----QASGWPDMGQ 241
            :|..:  ..||    ||.|:|.. .|.:|..|..:.||   ..:....:|     .|.||..|..
  Fly   117 SHPNWPAEGGR----DIGLIRTP-SVGFTDLINKVALP---SFSEESDRFVDTWCVACGWGGMDN 173

  Fly   242 GIASEVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYA 306
            |..::.|....:.......|:.:|.....:.:|....||..:..|||||||   |......|   
  Fly   174 GNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPL---VTHDNARL--- 232

  Fly   307 AGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338
            .|:|::|...|   ...|:.||:.:.:..||:
  Fly   233 VGVITFGSVDC---HSGPSGYTRVTDYLGWIR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 57/227 (25%)
Tryp_SPc 93..337 CDD:214473 55/224 (25%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 55/224 (25%)
Tryp_SPc 40..263 CDD:238113 57/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.