DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:92/245 - (37%) Gaps:78/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181
            ||||:|.:.:||||.||:........|...|.|     |:......:.||              .
  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR-----TNAQFTHWVGNG--------------N 110

  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ--------ASGW-- 236
            .|.|..        .||||:|:.. |.:...:..:.||      ::..::.        |.||  
  Fly   111 FIKHSS--------ADIALIRIPH-VDFWHMVNKVELP------SYNDRYNDYNEWWAVACGWGG 160

  Fly   237 -------PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLGSQI-CAGGLDGNDTSPGDSGGPLM 293
                   ||..|.:..:::        |...| |.|..::|..| |....||..|..||||||| 
  Fly   161 TYDGSPLPDYLQCVDLQII--------HNSEC-SGYYGSVGDNILCVRTPDGKSTCGGDSGGPL- 215

  Fly   294 ETVIRGKVTL--TYAAGIISYGQKPCVLKTCK---PAFYTKTSYFFEWIK 338
                   ||.  |...|:.::|.    :..|:   ||.:.:.:|..:||:
  Fly   216 -------VTHDGTKLVGVTNFGS----VAGCQSGAPAGFQRVTYHLDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 61/245 (25%)
Tryp_SPc 93..337 CDD:214473 59/242 (24%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 59/242 (24%)
Tryp_SPc 40..256 CDD:238113 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.