DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:91/247 - (36%) Gaps:81/247 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181
            ||||:|:|.:||||.||:....:       ||..|. ...||            |.....:....
  Fly    62 CGGSIISNEWVLTAEHCIGGDAV-------TVYFGA-TWRTN------------AQFTHWVGSGN 106

  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ--------ASGW-- 236
            .|||..        .||||:|:.. |.:...:..:.||      ::..::.        |.||  
  Fly   107 FITHGS--------ADIALIRIPH-VDFWHMVNKVELP------SYNDRYNDYNEWWAVACGWGG 156

  Fly   237 -------PDMGQGIASEVLLRSFIAERHPDVCKSNYDF-NLGSQ-ICAGGLDGNDTSPGDSGGPL 292
                   ||..|.:..:::        |...|.|.|.. .:|.. ||...:||..|..|||||||
  Fly   157 TYDGSPLPDYLQCVDLQII--------HNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPL 213

  Fly   293 ME---TVIRGKVTLTYAAGIISYGQKPCVLKTCK---PAFYTKTSYFFEWIK 338
            :.   :.:.|.......||             |:   ||.:.:.:|..:||:
  Fly   214 VTHDGSKLVGVTNWVSGAG-------------CQAGHPAGFQRVTYHLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 61/247 (25%)
Tryp_SPc 93..337 CDD:214473 59/244 (24%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 59/244 (24%)
Tryp_SPc 37..254 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.