DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG33465

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:256 Identity:76/256 - (29%)
Similarity:112/256 - (43%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPD 160
            ||||.:.   |||   :.:  |.|:|::..:|||||.|:......|      |..|.:|...:..
  Fly    46 PWMASIY---KNN---QFI--CDGTLVHKLFVLTAASCISKDSQLY------VLFGMYNQYRDAS 96

  Fly   161 RAIVNGRRQYAPLYMEIEVDQIITHEQF--NRGRRLINDIALVRLKFPVRYTRAIQPIC--LPRA 221
            :...|  .||.       |...:.|..|  |.|   :|||.|:||...|.:...|:|||  |...
  Fly    97 QFFNN--EQYG-------VAVALQHSNFRPNNG---VNDIGLLRLYGEVTHYAHIRPICIILDHV 149

  Fly   222 QKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSN---YDFNLGSQICAGGLDGNDT 283
            .|.|..:| |:..||...|...:|:|....:::::.|..|..|   ...|.| |.|||..| ...
  Fly   150 VKSAPFER-FEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEG-QFCAGNRD-RSF 211

  Fly   284 SPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKP-AFYTKTSYFFEWIKSKLQS 343
            ...:||.||......|...:|...|::|||.     :.|.| :.||....|.:||.:.:::
  Fly   212 CRSNSGSPLTADFTYGVKNITVQVGLVSYGS-----ELCSPTSVYTDVVAFKDWIYNTVRN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 76/251 (30%)
Tryp_SPc 93..337 CDD:214473 74/248 (30%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 76/251 (30%)
Tryp_SPc 46..261 CDD:214473 74/248 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.