DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG10472

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:307 Identity:90/307 - (29%)
Similarity:141/307 - (45%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IIGLRRCGTNKVCCPKWETYLP--HDTCGQSRRKPTKGKIPALNEFPW-MAMLLY--GNKNNLSQ 111
            |:|.:....|.|.....||.:|  |.....|.| .|.|:|...|:||: :.:|||  |.      
  Fly    14 ILGAQAVDWNSVKNLNIETPMPKVHGETLPSGR-ITGGQIAEPNQFPYQVGLLLYITGG------ 71

  Fly   112 KLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKT---VRLGEHNTSTNPDRAIVNGRRQYAPL 173
              ...|||::|::.:::|||||.:        :|.|   |.||.|      ||  .|.:.:...:
  Fly    72 --AAWCGGTIISDRWIITAAHCTD--------SLTTGVDVYLGAH------DR--TNAKEEGQQI 118

  Fly   174 YMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLP-RAQKLAAH-KRKFQASGW 236
            .. :|...:|.||.: ....:.|||:|::|..|:.:.:.|||..|| ::...:.: .....||||
  Fly   119 IF-VETKNVIVHEDW-IAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGW 181

  Fly   237 ---PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNL--GSQICAGGLDGNDTSPGDSGGPLMETV 296
               .|...| |:::|..:.:...:...|...| |.|  .|.||.....|..|..|||||||:  :
  Fly   182 GKISDSATG-ATDILQYATVPIMNNSGCSPWY-FGLVAASNICIKTTGGISTCNGDSGGPLV--L 242

  Fly   297 IRGKVTLTYAAGIISYGQKPCVLKTCK---PAFYTKTSYFFEWIKSK 340
            ..|..||   .|..|:|    :...|:   |..:|:.:|:.:||:.|
  Fly   243 DDGSNTL---IGATSFG----IALGCEVGWPGVFTRITYYLDWIEEK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 76/262 (29%)
Tryp_SPc 93..337 CDD:214473 74/259 (29%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 78/270 (29%)
Tryp_SPc 47..282 CDD:238113 79/271 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.