DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:92/233 - (39%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLY-MEIEVD 180
            ||||:|.|.:|:||.||.:        .:::|.:                  .|..|: ::.:..
  Fly    66 CGGSIIGNTWVMTAKHCTD--------GMESVTI------------------YYGALWRLQAQYT 104

  Fly   181 QIITHEQF-NRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQA--SGW-PDMGQ 241
            ..:....| ..|.   .||:|:|... |.:...:..:.|||......:.:.:.|  ||| ....:
  Fly   105 HWVGRSDFIEHGS---GDISLIRTPH-VDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDE 165

  Fly   242 GIASEVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIR------GK 300
            |..||.|....:......||::.|....|..||....:...|..|||||||   ||.      |.
  Fly   166 GGVSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPL---VIHDGNRQVGI 227

  Fly   301 VTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338
            |:...:||.:|.|.|..|          :.:.:.:||:
  Fly   228 VSFGSSAGCLSNGPKGMV----------RVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 58/233 (25%)
Tryp_SPc 93..337 CDD:214473 56/230 (24%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 56/230 (24%)
Tryp_SPc 41..257 CDD:238113 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.