DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:303 Identity:78/303 - (25%)
Similarity:115/303 - (37%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ETYLPHDTCGQSRRKPTKGKI---------PALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINN 124
            |..|.|    :||..|..|.|         .|:.:||:..    |....||......||||||.:
  Fly    18 EPELRH----RSREMPVVGDIGGRITGGSNAAVGQFPYQV----GLSLKLSALSSAWCGGSLIGS 74

  Fly   125 WYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFN 189
            .:|||||||.:.......|...|||.....|.|                   :....||.|..:|
  Fly    75 TWVLTAAHCTDGVQSVTVYLGATVRTSAEITHT-------------------VSSSDIIIHSGWN 120

  Fly   190 RGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ--------ASGW---PDMGQGI 243
             ...|.|||:|:::......:|.       .|.||.:....:.        ||||   .|...|:
  Fly   121 -SANLRNDISLIKIPATSSSSRI-------SAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGV 177

  Fly   244 ASEVLLRSFIAERHPDV-------CKSNYDFNL--GSQICAGGLDGNDTSPGDSGGPLMETVIRG 299
            |:.:        ::.|:       |...|..::  .|.:|....|...|..|||||||   |::.
  Fly   178 ATNL--------QYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPL---VLKS 231

  Fly   300 KVTLTYAAGIISYGQKPCVLKTCK---PAFYTKTSYFFEWIKS 339
            .   :...|:.|:|..    ..|:   ||.:|:.:.:.:|||:
  Fly   232 S---SEQIGLTSFGAS----AGCEKGYPAAFTRVTSYLDWIKT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 69/270 (26%)
Tryp_SPc 93..337 CDD:214473 66/266 (25%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 67/276 (24%)
Tryp_SPc 38..268 CDD:238113 70/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.