DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and yip7

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:274 Identity:68/274 - (24%)
Similarity:111/274 - (40%) Gaps:69/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR 149
            |.||.....:||:...|.:.:......     ||||:|.|.:|||||||.:.......|...|||
  Fly    41 TNGKDAVAGQFPYQVGLSFSSSAGSWW-----CGGSIIGNEWVLTAAHCTDGAASVTIYYGATVR 100

  Fly   150 LGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLI-----NDIALVRLKFPVRY 209
                   |:|                  |..|:::..:|.:....:     |||:|::.. .|.:
  Fly   101 -------TSP------------------EFTQVVSSSKFRQHESYLALTIRNDISLIQTS-SVSF 139

  Fly   210 TRAIQPICLPR-AQKLAAHKRKFQ-ASGW---PDMGQGIASEVLLRSFIAERHPD---VCKSNYD 266
            :..:..|.||. :...:.::.|.. ||||   .|....::.::        ::.|   :..|...
  Fly   140 SATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDL--------QYVDLTIISNSKCQ 196

  Fly   267 FNLGSQI------CAGGLDGNDTSPGDSGGPL-METVIRGKVTLTYAAGIISYGQKPCVLKTCKP 324
            ...||.|      |....:...|..||||||| ::.|:.|..:...|.|        |  ::..|
  Fly   197 ETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLIGATSFGSADG--------C--ESGAP 251

  Fly   325 AFYTKTSYFFEWIK 338
            |.:|:.:|:.:|||
  Fly   252 AAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 65/266 (24%)
Tryp_SPc 93..337 CDD:214473 62/263 (24%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 65/271 (24%)
Tryp_SPc 40..267 CDD:238113 68/274 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.