DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG10477

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:117/265 - (44%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR 149
            |.|...|.|:||:...|.:  |::.....   ||||:|.|.:|||||||.:.......|...|||
  Fly    41 TNGNKAAANQFPYQVGLSF--KSSAGSWW---CGGSIIANTWVLTAAHCTKGASSVTIYYGSTVR 100

  Fly   150 LGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFP-VRYTRAI 213
                 ||              |.|..::...:.:.|..:| ...|.|||:|:  |.| |.:|.:|
  Fly   101 -----TS--------------AKLKKKVSSSKFVQHAGYN-AATLRNDISLI--KTPSVTFTVSI 143

  Fly   214 QPICLPR-AQKLAAHK-RKFQASGW---PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNL--GS 271
            ..|.||. |...:.:. :...||||   .|....:|:.:....|....:. ||:..:..::  ..
  Fly   144 NKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNA-VCQKTFGSSVVTSG 207

  Fly   272 QICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISY-GQKPCVLKTCKPAFYTKTSYFFE 335
            .||...::...|..|||||||   .:..::     .|:.|: ..|.|  :...||.:|:.:.:.:
  Fly   208 VICVESINKKSTCQGDSGGPL---ALNNRL-----IGVTSFVSSKGC--EKNAPAGFTRVTSYLD 262

  Fly   336 WIKSK 340
            |||::
  Fly   263 WIKNQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 71/255 (28%)
Tryp_SPc 93..337 CDD:214473 68/252 (27%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/260 (27%)
Tryp_SPc 40..267 CDD:238113 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.