DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG10764

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:271 Identity:84/271 - (30%)
Similarity:124/271 - (45%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CGQSRR-KPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMD 140
            ||.|.| |.:.|...|.....|||.:.  |.::.      :|||::|:..:||:||||:...:..
  Fly    30 CGISTRPKISGGDDAAEPNSIWMAAIF--NSSDF------QCGGTIIHMRFVLSAAHCLVRGYDL 86

  Fly   141 YPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKF 205
            |      ||||..|.:              .|..:...::..:.|:......|  |||.|::|..
  Fly    87 Y------VRLGARNIN--------------EPAAVHTVINVFVHHDFIASEYR--NDIGLLQLSE 129

  Fly   206 PVRYTRAIQPIC--LPRAQKLAAHKRK-FQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYDF 267
            .:.||..:||||  |..|.|.:..|.| |:|.||.:. .|..|.:|...::.....:.||...:|
  Fly   130 SIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNR-NGKLSIMLQTIYLLHLKRNECKRKLNF 193

  Fly   268 NLGS-QICAGGLDGNDTSPGDSGGPLMETVI-RGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKT 330
            ||.| |||||..:| ||..|||||||...:: ....:.....||:|:|...|    .....||..
  Fly   194 NLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPEC----RGVGVYTDV 253

  Fly   331 SYFFEWIKSKL 341
            :.:.:||.|.:
  Fly   254 TSYVDWISSTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 76/251 (30%)
Tryp_SPc 93..337 CDD:214473 74/248 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 77/258 (30%)
Tryp_SPc 38..263 CDD:238113 78/260 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.