DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and scaf

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:324 Identity:80/324 - (24%)
Similarity:127/324 - (39%) Gaps:84/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TECVNLD-----KCPRTRAVMNSSRKNIIGLRRCGT-NKVCCPKWETYLPHDTCGQSRRKPTKGK 88
            |:|:..:     ||.|....::....|:.|:  |.| ||                  |.|||..|
  Fly   381 TDCLQTENGSPGKCCRDPNYVDPWPVNLAGV--CATRNK------------------RTKPTGVK 425

  Fly    89 IPALN--EFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVE-YPFMDYPYALKTVRL 150
            ....|  |.||.||:|    ...|:.|:  |||::|.:.:||::|.||. .|..|.     .|:.
  Fly   426 DLDANFAEIPWQAMIL----RESSKTLI--CGGAIIGDQFVLSSASCVNGLPVTDI-----RVKA 479

  Fly   151 GEHNT-STNPDRAIVNGRRQYAPLYMEIE-VDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAI 213
            ||... |||            .||..::. |..:..|..::.... .:|:|::||:..:.:...|
  Fly   480 GEWELGSTN------------EPLPFQLTGVKTVDVHPDYDPSTN-SHDLAIIRLERRLEFASHI 531

  Fly   214 QPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLL----------RSFIAERHPDVCK-SNYD- 266
            ||||:  :.:......:...|||......|..|..|          ||..:.....||. :.:| 
  Fly   532 QPICI--SDEDPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQARSECSADSSSVCSATKFDS 594

  Fly   267 --FNLGSQICAG--------GLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLK 320
              |::||.:..|        |:...:.|.|:.     :||...|..:.:.....:...||.:||
  Fly   595 CQFDVGSALACGSGSSVRLKGIFAGENSCGEG-----QTVRFAKPDIKWINTAFAENNKPLLLK 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 64/255 (25%)
Tryp_SPc 93..337 CDD:214473 64/255 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 54/213 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.