DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG17572

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:402 Identity:110/402 - (27%)
Similarity:168/402 - (41%) Gaps:102/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LFGLI----GSFLLMLQIILVPYSNGA--------------------------------GCQFDT 30
            ||.::    |.|    :.:|||.|:|:                                ||...|
  Fly    13 LFAIVRAESGEF----EKLLVPVSHGSAEQRSGARSNETTGHSVAARSYYDVVQNAGQTGCSVGT 73

  Fly    31 ECVNLDKCPRTRAVMNSSRKNIIGLRR--CGTNK-----VCCPKWETYLPHDTCGQSRRKPTKGK 88
            ||..|..|  |..:...:|....|.:.  ||.:.     ||||. .....:..||:|.   .:|.
  Fly    74 ECTPLHDC--TALIYEVARSCYYGDKSLYCGGSSEELPYVCCPS-SPLEKNQVCGKSL---VQGH 132

  Fly    89 I-PALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGE 152
            . ..|..:|::|.:  |.|:..:......|.|::|....:||||||. ....| .:.|.:||:||
  Fly   133 FYKGLGSYPFVARI--GFKHVNTGAFAYPCAGAVIARRVILTAAHCA-LAKAD-GHRLSSVRVGE 193

  Fly   153 HNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPIC 217
            ::||::||.|   .....||..:...:..:|.|..:.:| :..:||||:.||.|:.|:.|.||||
  Fly   194 YDTSSDPDCA---NTGFCAPRSVNHAISHVIVHPDYKQG-QYHHDIALLVLKTPLNYSVATQPIC 254

  Fly   218 LPRAQKLAAHKRKFQASGW----------PDMGQGIASEVLLRSFIAERHPDVCKSNYDFN---- 268
            |.:.:......::...:||          |:|..   .:|.|.|:      |:|..||...    
  Fly   255 LQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSH---LDVPLTSW------DLCLRNYGSTGALE 310

  Fly   269 -----LGSQICAGGLDGNDTSPGDSGGPL--METVIRGKVTLTYAAGIISYGQKPC-VLKTCKPA 325
                 .|..:|||| :|.|...|..|.||  .|..|..::      ||:|:|...| .|:.  |:
  Fly   311 SPNSIEGQWMCAGG-EGKDVCQGFGGAPLFIQENGIFSQI------GIMSFGSDNCGGLRI--PS 366

  Fly   326 FYTKTSYFFEWI 337
            .||..::|.|||
  Fly   367 VYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 80/267 (30%)
Tryp_SPc 93..337 CDD:214473 78/265 (29%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 80/267 (30%)
Tryp_SPc 138..378 CDD:214473 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.