DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG4650

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:260 Identity:65/260 - (25%)
Similarity:103/260 - (39%) Gaps:36/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR 149
            |.|||......||||.|       .:.:|:..|||::|....|||||||..      .......|
  Fly    32 TNGKIANNISSPWMAYL-------HTSELLYVCGGTVITEKLVLTAAHCTR------ASEQLVAR 83

  Fly   150 LGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQ 214
            :||...:.:.:..:::          |.:|.|...|..:|. ....||||::.|...:.:::.|:
  Fly    84 IGEFIGTDDANDTMLS----------EYQVSQTFIHSLYNT-TTSANDIAILGLATDIVFSKTIR 137

  Fly   215 PICL---PRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKS-NYDFNLGSQICA 275
            |||:   ...:|...:.:....:.|........|:....:.|..:..::|.: |....|.||.||
  Fly   138 PICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCA 202

  Fly   276 GGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPA-FYTKTSYFFEWIKS 339
            |..|....:. |...||...:....:......||.:..||      ||.| .||......::|.|
  Fly   203 GDSDSKLCNV-DFSSPLGAIITFKNIQRYVLIGIATTNQK------CKRASVYTDVLSHTDFILS 260

  Fly   340  339
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 61/252 (24%)
Tryp_SPc 93..337 CDD:214473 59/248 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 62/255 (24%)
Tryp_SPc 33..258 CDD:304450 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.