DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and sphe

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:229 Identity:51/229 - (22%)
Similarity:86/229 - (37%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181
            ||||:::...:||.||||.........:....|:|    |||          |||...: :.|:.
  Fly    51 CGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG----STN----------QYAGGKI-VNVES 100

  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICL-PRAQKLAAHKRKFQASGWPDMGQGIAS 245
            :..|..:   ..|.|::|::.|...:.||..|..|.| ...:.|.|...:...:||.....|..|
  Fly   101 VAVHPDY---YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNS 162

  Fly   246 EVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGII 310
            ..:.:..:.......|...|..:.....|........|..||.||        |.:......|:.
  Fly   163 YKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGTCHGDGGG--------GAIYGNTLIGLT 219

  Fly   311 SYGQKPCVLKTC---KPAFYTKTSYFFEWIKSKL 341
            ::     |:..|   .|..:.:.|.:.:||:.::
  Fly   220 NF-----VVGACGSRYPDVFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 51/226 (23%)
Tryp_SPc 93..337 CDD:214473 49/223 (22%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 51/226 (23%)
Tryp_SPc 42..244 CDD:214473 49/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.