DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG31220

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:347 Identity:143/347 - (41%)
Similarity:187/347 - (53%) Gaps:41/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CQFDTECVNLDKC------PRTRAVMNSSRKNIIGLRRCGTN----------KVCCPKWETYLP- 73
            |:.|.||:.|..|      .|...:..|::.||...|.||.:          .:||||....|| 
  Fly    27 CEPDEECIRLKDCRPIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIYICCPKPANTLPS 91

  Fly    74 HDTCG--QSRRKPTKGKIPALNEFPWMAMLLYGNKN--NLSQKLVPKCGGSLINNWYVLTAAHCV 134
            :..||  |:..:...|..|.|||:||:|||||.|::  |..::|||.|||||||..|||||||||
  Fly    92 YPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCV 156

  Fly   135 EYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLI-NDI 198
                .|....::.||||||.||.|||......|...||.:::|:|:.|.:|..::...... |||
  Fly   157 ----TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDI 217

  Fly   199 ALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQ-GIASEVLLRSFIAERHPD 259
            ||||||.|||||.|..|||:   ||    :..|.|...:||...|. ...|:||..:.:..|.|:
  Fly   218 ALVRLKEPVRYTMAYYPICVLDYPR----SLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPE 278

  Fly   260 VCKSNY---DFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKT 321
            .|...|   .|....||||||||...|..||||.|||.|..|...|:|:.|||.||| .||  .|
  Fly   279 ECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYG-GPC--GT 340

  Fly   322 CK-PAFYTKTSYFFEWIKSKLQ 342
            .. |:.:|:|:.|::||::.|:
  Fly   341 IGWPSVFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 117/257 (46%)
Tryp_SPc 93..337 CDD:214473 115/254 (45%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 118/264 (45%)
Tryp_SPc 104..360 CDD:238113 120/266 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.