DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG8952

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:297 Identity:81/297 - (27%)
Similarity:118/297 - (39%) Gaps:77/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PHDTCGQSRRKPTK-------GKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTA 130
            |.|....|   |.|       |....|.:|||..:|    |.:....|:  ||||:|::.:||||
  Fly    23 PFDPANSS---PIKIDNRIVSGSDAKLGQFPWQVIL----KRDAWDDLL--CGGSIISDTWVLTA 78

  Fly   131 AHC---VEYPFMDYPYALKTVRLGEHN----TSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQF 188
            |||   :...|:.:    .||.|...|    ||.|                       ||.|..:
  Fly    79 AHCTNGLSSIFLMF----GTVDLFNANALNMTSNN-----------------------IIIHPDY 116

  Fly   189 NRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIA--------- 244
            |  .:|.||::|::|..|:.::..||.|     |.:..:.......|......|..         
  Fly   117 N--DKLNNDVSLIQLPEPLTFSANIQAI-----QLVGQYGDSIDYVGSVATIAGFGYTEDEYLDY 174

  Fly   245 SEVLLRSFIAERHPDVCKSNYD--FNLGSQICAGGLDGND--TSPGDSGGPLMETVIRGKVTLTY 305
            ||.||.:.:.......|.:.|.  ..:.|.:||.|.||:|  |..|||||||   ::..|....:
  Fly   175 SETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL---ILYNKTIQQW 236

  Fly   306 -AAGIISY-GQKPCVLKTCKPAFYTKTSYFFEWIKSK 340
             ..||.|: .:..|..:.  |:.|.:.|.|..:|..|
  Fly   237 QQIGINSFVAEDQCTYRL--PSGYARVSSFLGFIADK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 73/268 (27%)
Tryp_SPc 93..337 CDD:214473 72/265 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 74/275 (27%)
Tryp_SPc 38..271 CDD:238113 75/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.