DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG31269

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:231 Identity:63/231 - (27%)
Similarity:97/231 - (41%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181
            |||::||..:|||||||||..|:  |:.:......::|..        .||.....:::....|.
  Fly    64 CGGAIINETFVLTAAHCVENAFI--PWLVVVTGTNKYNQP--------GGRYFLKAIHIHCNYDN 118

  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDM----GQG 242
            ...|          |||||:.|..|:.:....|||.||........  :...:||...    ...
  Fly   119 PEMH----------NDIALLELVEPIAWDERTQPIPLPLVPMQPGD--EVILTGWGSTVLWGTSP 171

  Fly   243 IASEVLLRSFIAERHPDVCK----SNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTL 303
            |..:||...::..|.   ||    ::.|.::| .||.....|.....|||||||        |:.
  Fly   172 IDLQVLYLQYVPHRE---CKALLSNDEDCDVG-HICTFSRLGEGACHGDSGGPL--------VSN 224

  Fly   304 TYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKS 339
            .|..|::::|. ||.  |..|..:....::.:||::
  Fly   225 GYLVGLVNWGW-PCA--TGVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 63/231 (27%)
Tryp_SPc 93..337 CDD:214473 61/227 (27%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 61/227 (27%)
Tryp_SPc 38..258 CDD:238113 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.