DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and spirit

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:373 Identity:100/373 - (26%)
Similarity:158/373 - (42%) Gaps:95/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LQIILVPYSNGAGCQFDT------ECVNLDKCPRTRAVMNSSRKNIIGLRRC----GTNKVCC-- 65
            |:.|:.|......||.:.      .|..::.||   :.:|...:.....:.|    ..:.|||  
  Fly    38 LRGIIFPVETFDECQLEDVARTKGTCRRMEDCP---SALNGWLERRESPKTCYFVRFDHYVCCAP 99

  Fly    66 --PKWETYLPHDTCGQSRR-----------------KPTKGKIPALNEFPWMAMLLYGNKNNLSQ 111
              ....|......|.:..:                 .||:.:     |||:||.|  |.::|..|
  Fly   100 AVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPR-----EFPFMAAL--GWRSNFDQ 157

  Fly   112 KLVPKCGGSLINNWYVLTAAHCV----EYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAP 172
            ::..:|||:||.|.:|||||||.    |.|        ..||||..|.:      :..|.     
  Fly   158 RIYYRCGGALIANNFVLTAAHCADLGGEPP--------SQVRLGGDNLT------LTEGE----- 203

  Fly   173 LYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWP 237
               :|.:.::|.|..:: .....|||||:.|:...:  ..::|.|:...:::.  .....|.|: 
  Fly   204 ---DISIRRVIIHPDYS-ASTAYNDIALLELETAAK--PELKPTCIWTQKEVT--NTLVTAIGY- 259

  Fly   238 DMGQ----GIASEVLLRSFIAERHPDVCKSNYDFN------LGSQICAGGLDG-NDTSPGDSGGP 291
              ||    |::|..||:..:.....:.|:.:|..:      ||:|:|||.:.| .||..||||||
  Fly   260 --GQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGP 322

  Fly   292 -LMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338
             ||:..:.|     |..||.|.|| .|.  :..|:.||:.|.|.:||:
  Fly   323 LLMQDGLLG-----YVVGITSLGQ-GCA--SGPPSVYTRVSSFVDWIE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 83/262 (32%)
Tryp_SPc 93..337 CDD:214473 81/259 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/49 (18%)
Tryp_SPc 132..364 CDD:238113 85/276 (31%)
Tryp_SPc 132..361 CDD:214473 83/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.