DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG32260

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:284 Identity:88/284 - (30%)
Similarity:128/284 - (45%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TCGQS---RRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYP 137
            |||.|   ..:...|.......:||:|.|.|..:|| ...|...||||||::.||:|:|||:. |
  Fly   317 TCGISGATSNRVVGGMEARKGAYPWIAALGYFEENN-RNALKFLCGGSLIHSRYVITSAHCIN-P 379

  Fly   138 FMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVR 202
            .      |..||||.|:.|...:...           |::.:.:.:.||.|:. ..:.|||||:.
  Fly   380 M------LTLVRLGAHDLSQPAESGA-----------MDLRIRRTVVHEHFDL-NSISNDIALIE 426

  Fly   203 LKFPVRYTRAIQPICLPRAQKLAAHKRKFQ-----ASGWPDM-GQGIASEVL--LRSFIAERHPD 259
            |.........|.|||||.|.|..  ::.|.     .:||..: .||:.|:||  .:..|..||. 
  Fly   427 LNVVGALPGNISPICLPEAAKFM--QQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHS- 488

  Fly   260 VCKSNYD-----FNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVL 319
             |:.:|.     .....::...|....|...||||||||...:.|.|...|..|::|:|.: |. 
  Fly   489 -CEQSYKSIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYE-CA- 550

  Fly   320 KTCKPAFYTKTSYFFEWIKSKLQS 343
            :...|..||:.:.:..|||..:.|
  Fly   551 RPNFPGVYTRVASYVPWIKKHIAS 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/259 (32%)
Tryp_SPc 93..337 CDD:214473 79/256 (31%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 80/266 (30%)
Tryp_SPc 328..571 CDD:238113 83/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.