DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG11664

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:273 Identity:69/273 - (25%)
Similarity:103/273 - (37%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IPALNEFPWMAMLLYGNKNNLSQKLVPK--CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLG 151
            ||...:.....|.:||          |:  ..|||.:..||||.|||.:                
  Fly    27 IPVQQQNYGYVMQIYG----------PQFLAAGSLFSARYVLTVAHCFK---------------- 65

  Fly   152 EHNTSTNPDRAIVN-GRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQP 215
               .:|.|:...|. |.|..|..:...:|..::.|.:|: ...|.||||::|:|..:.::..|..
  Fly    66 ---KNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFS-PLTLRNDIAVLRVKAAISHSHMINY 126

  Fly   216 I--CLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDV-CKSNYDFNLGSQICAGG 277
            |  |......|.......:.:||..|  .||..  |:|...:..|:. |:..:....|..|||..
  Fly   127 IGLCSRPLTPLNMFAPPQELAGWNLM--HIAQP--LKSMSVQVEPEKNCRQWFPQISGGVICASA 187

  Fly   278 LDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKLQ 342
            ..|.....||||.||    |.|......|......|.|.      .||.:|...|...:|...:.
  Fly   188 TMGEGLCYGDSGDPL----ISGGEVCGLAIAFRKCGDKR------YPALFTDVHYHRAFIAQAVL 242

  Fly   343 SPFIDSDSKSRTR 355
            :  :|.:..|::|
  Fly   243 T--LDREMLSKSR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 64/252 (25%)
Tryp_SPc 93..337 CDD:214473 63/249 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 64/244 (26%)
Tryp_SPc 38..237 CDD:214473 63/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.