DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and f10

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:252 Identity:72/252 - (28%)
Similarity:128/252 - (50%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPD 160
            ||.|:|:  |:||:.     .|||:::...::|:||||     |:...:::.| :||::|.....
Zfish   257 PWQALLI--NENNMG-----FCGGTILTEHFILSAAHC-----MNESLSIRVV-VGEYDTLVPEG 308

  Fly   161 RAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPR---AQ 222
            |...:            :||:|:.|:.: :.....|||||::|..|:::|:.|.|.|||.   |:
Zfish   309 REATH------------DVDEILIHKNY-QPDTYHNDIALIKLSKPIKFTKYIIPACLPEMKFAE 360

  Fly   223 KLAAHKRKFQASGWPDMGQ-GIASEVLLRSFIAERHPDVCKSNYDFNL-GSQICAG-GLDGNDTS 284
            ::...:.....||:..:.: |::|.:|.:..:...:...|..:.:|.: |...||| ..:..|..
Zfish   361 RVLMQQDDGLVSGFGRVREGGLSSTILQKLTVPYVNRAKCIESSNFKISGRMFCAGYDQEEKDAC 425

  Fly   285 PGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKL 341
            .||||||   .|.|.|.| .:..|::|:|: .|..|. |...||:.|.:..||.:.:
Zfish   426 QGDSGGP---HVTRFKNT-WFITGVVSWGE-GCARKG-KYGVYTQVSKYIMWINNAM 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 72/249 (29%)
Tryp_SPc 93..337 CDD:214473 70/246 (28%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 70/246 (28%)
Tryp_SPc 245..474 CDD:238113 72/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.