DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG18420

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:116/273 - (42%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CGQSRRKPTK-------GKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCV 134
            ||  .|.|.|       ||:...|..||||.|     :..|.:.:  |||:||:...|||||||.
  Fly    31 CG--TRSPLKLGPRIVNGKVAVRNSSPWMAFL-----HTSSNQFI--CGGTLISRRLVLTAAHCF 86

  Fly   135 EYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIA 199
                  .|.....|||||:|..       :.|.|:      |.:|::...|..::.... .||||
  Fly    87 ------IPNTTIVVRLGEYNRK-------LKGYRE------EHQVNRTFQHRFYDPNTH-ANDIA 131

  Fly   200 LVRLKFPVRYTRAIQPICLPRAQKLAAH---KRKFQASGWPDMGQGIASEVLLRSFIAERHPD-V 260
            |:||...|.|...|:|||:........|   .:....:|| ...:.:.....||:....|.|. :
  Fly   132 LLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGW-GRTESMHDSSELRTLDISRQPSKM 195

  Fly   261 CKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPA 325
            |.  :...|.:|.|||..:.| ...||:||| :..::|.:....:....|:...|.|.    :|:
  Fly   196 CA--FGSVLSNQFCAGNWNSN-LCIGDTGGP-VGAMVRYRNAFRFVQVGIAITNKRCQ----RPS 252

  Fly   326 FYTKTSYFFEWIK 338
            .:|......|:|:
  Fly   253 VFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 71/250 (28%)
Tryp_SPc 93..337 CDD:214473 70/247 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 72/257 (28%)
Tryp_SPc 43..267 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.