DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG18636

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:271 Identity:86/271 - (31%)
Similarity:117/271 - (43%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CG---QSRR--KPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEY 136
            ||   |||.  :...|.....|..|||..|     ::.:...|  ||||||.:..|||||||   
  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFL-----HSTTDMFV--CGGSLITDKLVLTAAHC--- 87

  Fly   137 PFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALV 201
             |:...:.:  .||||:..:.:.:   ..|  .|.....|..||....|:.::.... .||||::
  Fly    88 -FIANQHLV--ARLGEYERTRSEE---CTG--YYCNFREEHMVDAGFKHKLYDPNTH-ANDIAIL 143

  Fly   202 RLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ---ASGWPDMGQGIASEVLLRSFIAERHPDVCKS 263
            ||...|.|...|:|||:....:...:..|..   |:||........|:.|....|..:.||||..
  Fly   144 RLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAK 208

  Fly   264 NYDFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYA-AGIISYGQKPCVLKTCKPAF 326
            .....: |:|.|||..|.| ...||||||| ..||..|.|..:. .||.||..:.|.    |.:.
  Fly   209 FIGQTIAGNQFCAGNWDSN-LCNGDSGGPL-GAVITHKNTQRFVQVGIASYTNRNCQ----KASV 267

  Fly   327 YTKTSYFFEWI 337
            :|......|:|
  Fly   268 FTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 80/250 (32%)
Tryp_SPc 93..337 CDD:214473 79/248 (32%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 80/258 (31%)
Tryp_SPc 45..278 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.