DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG30323

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:211 Identity:42/211 - (19%)
Similarity:67/211 - (31%) Gaps:99/211 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLMLQIILVPYSNGA--GCQFDTECVNLDKCPRTRAVMNSSRKNIIGLRRCGTNKVCCPKWETY 71
            |||:|.:....|||..  |.|            |...|.::..:|::.:|   |.|        :
  Fly     3 FLLLLLLTSSAYSNEGKKGLQ------------RNLYVTDNYHQNVVSIR---TRK--------H 44

  Fly    72 LPHDTCGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEY 136
            :.|                      |       ..|:.       |.|||::.|:|:|:..||  
  Fly    45 IRH----------------------W-------GDNHF-------CAGSLLSAWWVVTSGCCV-- 71

  Fly   137 PFMDYPYALKTVRLGEHNTSTNPD------------RAIV-NGRRQYAPLYMEI-EVDQIITHEQ 187
                               ||.|:            |.:| ..:|...|....| .|.:|:..|.
  Fly    72 -------------------STRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDES 117

  Fly   188 FNRGRRLINDIALVRL 203
            ...|   ..::||::|
  Fly   118 AISG---CTELALLKL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 26/125 (21%)
Tryp_SPc 93..337 CDD:214473 26/125 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 27/146 (18%)
Tryp_SPc 45..272 CDD:214473 27/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.